Acetyl-CoA Carboxylase beta antibody (ACACB) (AA 22-120) Primary Antibody
ACACB
Reactivity: Human
ELISA, WB
Host: Mouse
Monoclonal
1C11
unconjugated
camera_alt 1
Catalog No. ABIN513048
$364.00
Plus shipping costs $45.00
200 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 22-120
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- This Acetyl-CoA Carboxylase beta antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a partial recombinant ACACB.
- Cross-Reactivity
- Human
- Immunogen
immunogen: ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
- Clone
- 1C11
- Isotype
- IgM kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In ascites fluid
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- ACACB (ACACB Antibody Abstract)
- Synonyms
- F15C21.2, F15C21_2, acetyl-CoA carboxylase 2, ACC2, ACCB, HACC275, Acc2, AI597064, AW743042, Accb, acetyl-CoA carboxylase 2, acetyl-CoA carboxylase beta, acetyl-Coenzyme A carboxylase beta, ACC2, ACACB, Acacb
- Background
- Full Gene Name: acetyl-Coenzyme A carboxylase beta
Synonyms: ACC2,ACCB,HACC275 - Gene ID
- 32
- NCBI Accession
- NP_001084, NM_001093
- Pathways
- AMPK Signaling, Ribonucleoside Biosynthetic Process
You are here: