Acetyl-CoA Carboxylase beta antibody (ACACB) (AA 22-120)

Details for Product anti-ACACB Antibody No. ABIN513048
Target
Binding Specificity
AA 22-120
15
9
1
1
1
1
Reactivity
Human
36
9
2
1
Host
Mouse
26
11
1
Clonality (Clone)
Monoclonal ()
Conjugate
This Acetyl-CoA Carboxylase beta antibody is un-conjugated
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
15
13
10
5
3
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant ACACB.
Immunogen

immunogen: ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT

Clone 1C11
Isotype IgM kappa
Cross-Reactivity Human
Target
Alternative Name ACACB (ACACB Antibody Abstract)
Background Full Gene Name: acetyl-Coenzyme A carboxylase beta
Synonyms: ACC2,ACCB,HACC275
Gene ID 32
NCBI Accession NP_001084, NM_001093
Pathways AMPK Signaling, Ribonucleoside Biosynthetic Process
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer In ascites fluid
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Acetyl-CoA Carboxylase beta (ACACB) (AA 22-120) antibody (ABIN513048) Western Blot detection against Immunogen (36.63 KDa) .