Mediterranean Fever (MEFV) (AA 1-110) antibody

Details for Product No. ABIN517844
Target
Binding Specificity
AA 1-110
16
15
8
5
2
2
1
1
Reactivity
Human
37
4
3
3
2
2
2
2
1
1
1
Host
Mouse
28
7
2
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
3
3
3
3
3
3
Application
Immunofluorescence (IF), ELISA, Western Blotting (WB)
35
26
2
2
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant MEFV.
Immunogen

immunogen: MEFV (NP_000234, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL

Clone 2C1
Isotype IgG2a kappa
Cross-Reactivity Human
Target
Alternative Name MEFV (MEFV Antibody Abstract)
Background Full Gene Name: Mediterranean fever
Synonyms: FMF,MEF,MGC126560,MGC126586,TRIM20
Gene ID 4210
NCBI Accession NP_000234, NM_000243
Pathways Positive Regulation of Endopeptidase Activity
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Mediterranean Fever (MEFV) (AA 1-110) antibody (ABIN517844) Detection limit for recombinant GST tagged MEFV is 0.03 ng/ml as a capture antibody.
Image no. 2 for anti-Mediterranean Fever (MEFV) (AA 1-110) antibody (ABIN517844) Western Blot detection against Immunogen (37.84 KDa) .
Image no. 3 for anti-Mediterranean Fever (MEFV) (AA 1-110) antibody (ABIN517844) Immunofluorescence of monoclonal antibody to MEFV on HeLa cell. [antibody concentrati...