MEIS2 antibody (Meis Homeobox 2) (AA 1-470)

Details for Product anti-MEIS2 Antibody No. ABIN517848
Antigen
  • HsT18361
  • MRG1
  • A430109D20Rik
  • Mrg1
  • Stra10
  • Meis2a.1
  • Meis2a.2
  • mrg1
  • MEIS2
  • hst18361
  • DKFZp469A1832
  • meis2
  • meis2.1
  • Meis homeobox 2
  • Meis homeobox 2 L homeolog
  • Meis homeobox 2b
  • MEIS2
  • Meis2
  • meis2.L
  • meis2
  • meis2b
Epitope
AA 1-470
14
10
7
7
7
5
4
3
2
1
1
1
1
1
1
Reactivity
Human
82
42
31
7
7
6
6
6
6
3
3
3
3
3
3
Host
Rabbit
67
12
7
Clonality
Polyclonal
Conjugate
This MEIS2 antibody is un-conjugated
6
5
5
3
3
3
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
63
38
27
20
13
8
7
3
2
Options
Purpose Rabbit polyclonal antibody raised against a full-length human MEIS2 protein.
Brand MaxPab®
Immunogen

immunogen: MEIS2 (NP_733776.1, 1 a.a. ~ 470 a.a) full-length human protein.

Immunogen Sequence: MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ

Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others MEIS2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name MEIS2 (MEIS2 Antibody Abstract)
Background Full Gene Name: Meis homeobox 2
Synonyms: HsT18361,MGC2820,MRG1
Gene ID 4212
NCBI Accession NP_733776, NM_170676
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Meis Homeobox 2 (MEIS2) (AA 1-470) antibody (ABIN517848) Western Blot analysis of MEIS2 expression in transfected 293T cell line by MEIS2 MaxP...
Did you look for something else?