Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody

Details for Product No. ABIN521072
Antigen
Epitope
AA 35-138
22
18
17
14
10
8
5
5
3
2
2
2
1
1
Reactivity
Human
175
108
94
3
3
3
3
1
Host
Mouse
172
17
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
18
8
6
6
6
6
6
6
6
3
3
2
2
2
2
2
2
1
Application
ELISA, Western Blotting (WB)
132
77
47
30
30
29
15
11
10
8
5
3
3
2
2
2
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant TPT1.
Immunogen

immunogen: TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC

Clone 2C4
Isotype IgG2a kappa
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Antigen
Alternative Name TPT1 (TPT1 Antibody Abstract)
Background Full Gene Name: tumor protein, translationally-controlled 1
Synonyms: FLJ27337,HRF,TCTP,p02
Gene ID 7178
Pathways Response to Water Deprivation, Regulation of Cell Size, Negative Regulation of intrinsic apoptotic Signaling
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a captur...
Image no. 2 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 3 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 4 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 5 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4 Western Blot analysis of TPT1 expression in...
Product cited in: Sinthujaroen, Wanachottrakul, Pinkaew, Petersen, Phongdara, Sheffield-Moore, Fujise: "Elevation of serum fortilin levels is specific for apoptosis and signifies cell death in vivo." in: BBA clinical, Vol. 2, pp. 103-111, 2015 (PubMed).