Transcription Elongation Factor A (SII)-Like 1 (TCEAL1) (AA 1-159) antibody

Details for Product No. ABIN522796
Target
Binding Specificity
AA 1-159
16
15
4
2
2
1
1
1
1
1
1
1
1
Reactivity
Human
44
12
12
4
3
2
2
2
1
Host
Mouse
30
7
7
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
3
3
3
3
3
3
Application
Immunoprecipitation (IP), ELISA, Western Blotting (WB)
37
28
7
4
3
3
1
1
1
Options
Purpose Mouse monoclonal antibody raised against a full-length recombinant TCEAL1.
Immunogen

immunogen: TCEAL1 (AAH00809, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI

Clone 3B9
Isotype IgG2a kappa
Cross-Reactivity Human
Target
Alternative Name TCEAL1 (TCEAL1 Antibody Abstract)
Background Full Gene Name: transcription elongation factor A (SII)-like 1
Synonyms: SIIR,p21,pp21
Gene ID 9338
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Transcription Elongation Factor A (SII)-Like 1 (TCEAL1) (AA 1-159) antibody (ABIN522796) Detection limit for recombinant GST tagged TCEAL1 is 0.1 ng/ml as a capture antibody.
Image no. 2 for anti-Transcription Elongation Factor A (SII)-Like 1 (TCEAL1) (AA 1-159) antibody (ABIN522796) Western Blot analysis of TCEAL1 expression in transfected 293T cell line by TCEAL1 mo...
Image no. 3 for anti-Transcription Elongation Factor A (SII)-Like 1 (TCEAL1) (AA 1-159) antibody (ABIN522796) Immunoprecipitation of TCEAL1 transfected lysate using anti-TCEAL1 monoclonal antibod...