Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Leprecan-Like 4 (LEPREL4) (AA 270-379) antibody Primary Antibody

LEPREL4 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1E12 unconjugated
Catalog No. ABIN524031
$440.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Leprecan-Like 4 (LEPREL4)
    Binding Specificity
    AA 270-379
    • 10
    • 7
    • 3
    • 3
    • 3
    • 1
    Reactivity
    Human
    • 25
    • 12
    • 12
    Host
    Mouse
    Clonality
    Monoclonal
    Conjugate
    Un-conjugated
    • 10
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 18
    • 10
    • 2
    • 1
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant SC65.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SC65 (NP_006446, 270 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: QCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQS

    Clone
    1E12
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Leprecan-Like 4 (LEPREL4)
    Alternative Name
    SC65 (LEPREL4 Antibody Abstract)
    Synonyms
    NO55, NOL55, SC65, 1110036O03Rik, AI413214, Sc65, prolyl 3-hydroxylase family member 4 (non-enzymatic), P3H4, P3h4
    Background
    Full Gene Name: synaptonemal complex protein SC65
    Synonyms: NOL55
    Gene ID
    10609
    NCBI Accession
    NP_006446, NM_006455
You are here:
help Support