Leprecan-Like 4 (LEPREL4) (AA 270-379) antibody

Details for Product No. ABIN524031
Target
Binding Specificity
AA 270-379
9
7
3
3
2
1
Reactivity
Human
24
12
12
Host
Mouse
23
1
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
3
2
1
1
1
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
17
10
2
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant SC65.
Immunogen

immunogen: SC65 (NP_006446, 270 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: QCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQS

Clone 1E12
Isotype IgG2a kappa
Cross-Reactivity Human
Target
Alternative Name SC65 (LEPREL4 Antibody Abstract)
Background Full Gene Name: synaptonemal complex protein SC65
Synonyms: NOL55
Gene ID 10609
NCBI Accession NP_006446, NM_006455
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Leprecan-Like 4 (LEPREL4) (AA 270-379) antibody (ABIN524031) Western Blot analysis of SC65 expression in transfected 293T cell line by SC65 monocl...