Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Stabilin 1 (STAB1) (AA 1804-1902) antibody Primary Antibody

STAB1 Reactivity: Human IF, ELISA, WB Host: Mouse Monoclonal 4G9 unconjugated
Catalog No. ABIN524998
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Stabilin 1 (STAB1)
    Binding Specificity
    AA 1804-1902
    • 7
    • 2
    • 1
    • 1
    Reactivity
    Human
    • 29
    • 16
    • 15
    Host
    Mouse
    • 18
    • 7
    • 3
    • 1
    Clonality
    Monoclonal
    • 27
    • 2
    Conjugate
    Un-conjugated
    • 6
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), ELISA, Western Blotting (WB)
    • 13
    • 12
    • 5
    • 5
    • 3
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant STAB1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

    Clone
    4G9
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Stabilin 1 (STAB1)
    Alternative Name
    STAB1 (STAB1 Antibody Abstract)
    Synonyms
    CLEVER-1, FEEL-1, FELE-1, FEX1, STAB-1, STAB1, stab1, MFEEL-1, MS-1, mKIAA0246, stabilin 1, dedicator of cytokinesis 9b, stabilin-1, STAB1, dock9b, Stab1, LOC100599991
    Background
    Full Gene Name: stabilin 1
    Synonyms: CLEVER-1,FEEL-1,FELE-1,FEX1,KIAA0246,STAB-1
    Gene ID
    23166
    NCBI Accession
    NP_055951, NM_015136
You are here:
help Support