PCDHA7 antibody (Protocadherin alpha 7) (AA 143-241)

Details for Product anti-PCDHA7 Antibody No. ABIN527875
Antigen
Epitope
AA 143-241
9
8
7
7
3
1
1
Reactivity
Human
23
Host
Mouse
18
5
Clonality (Clone)
Monoclonal ()
Conjugate
This PCDHA7 antibody is un-conjugated
2
2
2
2
2
2
Application
ELISA, Western Blotting (WB)
23
19
16
3
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant PCDHA7.
Immunogen

immunogen: PCDHA7 (NP_061733, 143 a.a. ~ 241 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: AESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPV

Clone 4G3
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name PCDHA7 (PCDHA7 Antibody Abstract)
Background Full Gene Name: protocadherin alpha 7
Synonyms: CNR4,CNRN4,CNRS4,CRNR4,PCDH-ALPHA7
Gene ID 56141
NCBI Accession NP_061733, NM_018910
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protocadherin alpha 7 (PCDHA7) (AA 143-241) antibody (ABIN527875) Western Blot detection against Immunogen (36.63 KDa) .
Image no. 2 for anti-Protocadherin alpha 7 (PCDHA7) (AA 143-241) antibody (ABIN527875) Detection limit for recombinant GST tagged PCDHA7 is 0.3 ng/ml as a capture antibody.
Image no. 3 for anti-Protocadherin alpha 7 (PCDHA7) (AA 143-241) antibody (ABIN527875) Western Blot analysis of PCDHA7 expression in transfected 293T cell line by PCDHA7 mo...