NDRG2 antibody (NDRG Family Member 2) (AA 1-96)

Details for Product anti-NDRG2 Antibody No. ABIN528174
Antigen
Epitope
AA 1-96
17
10
10
9
8
5
4
2
2
2
2
2
1
1
1
1
Reactivity
Human
89
48
47
6
5
5
4
3
3
3
2
1
1
Host
Mouse
80
9
7
Clonality
Polyclonal
Conjugate
This NDRG2 antibody is un-conjugated
5
3
3
3
3
3
2
2
2
2
2
2
Application
ELISA, Western Blotting (WB)
78
48
23
8
2
2
2
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant NDRG2.
Immunogen

immunogen: NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP

Cross-Reactivity Human
Antigen
Alternative Name NDRG2 (NDRG2 Antibody Abstract)
Background Full Gene Name: NDRG family member 2
Synonyms: DKFZp781G1938,FLJ25522,KIAA1248,SYLD
Gene ID 57447
NCBI Accession NP_057334, NM_016250
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-NDRG Family Member 2 (NDRG2) (AA 1-96) antibody (ABIN528174) Western Blot detection against Immunogen (36.67 KDa) .
Product cited in: Flügge, Araya-Callis, Garea-Rodriguez, Stadelmann-Nessler, Fuchs: "NDRG2 as a marker protein for brain astrocytes." in: Cell and tissue research, Vol. 357, Issue 1, pp. 31-41, 2014 (PubMed).

Araya-Callís, Hiemke, Abumaria, Flugge: "Chronic psychosocial stress and citalopram modulate the expression of the glial proteins GFAP and NDRG2 in the hippocampus." in: Psychopharmacology, Vol. 224, Issue 1, pp. 209-22, 2012 (PubMed).