PAS Domain Containing 1 (PASD1) (AA 1-100) antibody

Details for Product No. ABIN530755
Antigen
  • CT63
  • OXTES1
  • PAS domain containing repressor 1
  • PASD1
Epitope
AA 1-100
16
8
7
7
4
3
Reactivity
Human
34
1
1
Host
Mouse
24
10
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
3
3
3
2
2
2
Application
ELISA, Western Blotting (WB)
31
28
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant PASD1.
Immunogen

immunogen: PASD1 (NP_775764, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL

Clone 2B10
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name PASD1 (PASD1 Antibody Abstract)
Background Full Gene Name: PAS domain containing 1
Synonyms:
Gene ID 139135
NCBI Accession NP_775764, NM_173493
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-PAS Domain Containing 1 (PASD1) (AA 1-100) antibody (ABIN530755) PASD1 monoclonal antibody (M04), clone 2B10 Western Blot analysis of PASD1 expression...
Image no. 2 for anti-PAS Domain Containing 1 (PASD1) (AA 1-100) antibody (ABIN530755) Detection limit for recombinant GST tagged PASD1 is 0.3 ng/ml as a capture antibody.
Image no. 3 for anti-PAS Domain Containing 1 (PASD1) (AA 1-100) antibody (ABIN530755) Western Blot detection against Immunogen (37 KDa) .
Did you look for something else?