ANGPTL2 antibody (Middle Region)

Catalog No. ABIN5518733

Product Details anti-ANGPTL2 Antibody

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Binding Specificity: AA 275-312, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANGPTL2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: WRDCLQALED GHDTSSIYLV KPENTNRLMQ VWCDQRHD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: angiopoietin like 2
Protein Name: Angiopoietin-related protein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ANGPTL2

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Alternative Name: ANGPTL2 (ANGPTL2 Products)

Synonyms: ARP2 antibody, HARP antibody, AI593246 antibody, AW260363 antibody, Arp2 antibody, ANGPTL2 antibody, angptl2 antibody, wu:fc41g02 antibody, arp2 antibody, fbnl antibody, harp antibody, angptl2a antibody, angiopoietin like 2 antibody, angiopoietin-like 2 antibody, angiopoietin-like 2b antibody, angiopoietin like 2 L homeolog antibody, ANGPTL2 antibody, Angptl2 antibody, angptl2b antibody, angptl2 antibody, angptl2.L antibody

Background: Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

Synonyms: AI593246 | Angptl2 | Arp2 | HARP | MGC8889 | UNQ170/PRO196 | Q9UKU9

Gene ID: 23452