ATF6 antibody (C-Term)

Catalog No. ABIN5518809

Product Details anti-ATF6 Antibody

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Binding Specificity: AA 597-629, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATF6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: AININENVIN GQDYEVMMQI DCQVMDTRIL HIK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: activating transcription factor 6
Protein Name: Cyclic AMP-dependent transcription factor ATF-6 alpha

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ATF6

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Alternative Name: ATF6 (ATF6 Products)

Synonyms: ATF-6-like antibody, GB16435 antibody, ATF6 antibody, Atf6 antibody, ATF6A antibody, 9130025P16Rik antibody, 9630036G24 antibody, AA789574 antibody, Atf6alpha antibody, ESTM49 antibody, activating transcription factor 6 antibody, uncharacterized LOC412432 antibody, activating transcription factor 6 S homeolog antibody, cyclic AMP-dependent transcription factor ATF-6 alpha antibody, ATF6 antibody, LOC412432 antibody, atf6.S antibody, LOC100122162 antibody, Atf6 antibody

Background: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

Synonyms: Cyclic AMP-dependent transcription factor ATF-6 alpha | cAMP-dependent transcription factor ATF-6 alpha | Activating transcription factor 6 alpha | ATF6-alpha | Processed cyclic AMP-dependent transcription factor ATF-6 alpha | ATF6 | P18850

Gene ID: 22926

UniProt: P18850

Pathways: ER-Nucleus Signaling, Unfolded Protein Response