CRX antibody (C-Term)
-
- Target See all CRX Antibodies
- CRX (Cone-Rod Homeobox (CRX))
-
Binding Specificity
- AA 265-299, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRX antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Cone-rod homeobox protein(CRX) detection. Tested with WB in Human.
- Sequence
- DSLEFKDPTG TWKFTYNPMD PLDYKDQSAW KFQIL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cone-rod homeobox protein(CRX) detection. Tested with WB in Human.
Gene Name: cone-rod homeobox
Protein Name: Cone-rod homeobox protein - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product CRX Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CRX (Cone-Rod Homeobox (CRX))
- Alternative Name
- CRX (CRX Products)
- Synonyms
- Xotx5 antibody, Xotx5b antibody, cord2 antibody, crd antibody, otx5 antibody, otx5b antibody, rx antibody, CRX antibody, crx antibody, otx5-b antibody, CORD2 antibody, CRD antibody, LCA7 antibody, OTX3 antibody, Crx1 antibody, otx5-A antibody, cone-rod homeobox antibody, cone-rod homeobox L homeolog antibody, cone-rod homeobox S homeolog antibody, crx antibody, CRX antibody, Crx antibody, crx.L antibody, crx.S antibody
- Background
-
Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
Synonyms: CORD 2 | CRD | CRX | LCA 7 | LCA7 | OTX 3 | OTX3 | O43186 - Gene ID
- 1406
- UniProt
- O43186
-