ErbB2/Her2 antibody (N-Term)
-
- Target See all ErbB2/Her2 Antibodies
- ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))
-
Binding Specificity
- AA 29-64, N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ErbB2/Her2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
- Sequence
- TDMKLRLPAS PETHLDMLRH LYQGCQVVQG NLELTY
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: erb-b2 receptor tyrosine kinase 2
Protein Name: Receptor tyrosine-protein kinase erbB-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product ErbB2/Her2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism." in: Acta pharmacologica Sinica, Vol. 35, Issue 6, pp. 846-52, (2015) (PubMed).
: "In vitro study on human cytomegalovirus affecting early pregnancy villous EVT's invasion function." in: Virology journal, Vol. 8, pp. 114, (2011) (PubMed).
: "
-
Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism." in: Acta pharmacologica Sinica, Vol. 35, Issue 6, pp. 846-52, (2015) (PubMed).
-
- Target
- ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))
- Alternative Name
- ERBB2 (ErbB2/Her2 Products)
- Synonyms
- CD340 antibody, HER-2 antibody, HER-2/neu antibody, HER2 antibody, MLN 19 antibody, NEU antibody, NGL antibody, TKR1 antibody, Erbb-2 antibody, Neu antibody, c-erbB2 antibody, c-neu antibody, mKIAA3023 antibody, wu:fv70f10 antibody, zgc:63601 antibody, erb2 antibody, erb-b2 receptor tyrosine kinase 2 antibody, ERBB2 antibody, Erbb2 antibody, erbb2 antibody
- Background
-
Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Synonyms: C erb B2/neu protein | Cerb B2/neu protein | CD340 | CD340 antigen | CerbB2 | ERBB2 | HER 2 | HER 2/NEU | HER2 | Herstatin | MLN19 | MLN 19 | NEU | NGL | p185erbB2 | TKR1 | P04626 - Gene ID
- 2064
- UniProt
- P04626
- Pathways
- RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development
-