OTC antibody (N-Term)

Catalog No. ABIN5518860

Product Details anti-OTC Antibody

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Binding Specificity: AA 33-70, N-Term

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTC antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Ornithine carbamoyltransferase, mitochondrial(OTC) detection. Tested with WB in Human,Mouse,Rat.

Sequence: NKVQLKGRDL LTLKNFTGEE IKYMLWLSAD LKFRIKQK

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Ornithine carbamoyltransferase, mitochondrial(OTC) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ornithine carbamoyltransferase
Protein Name: Ornithine carbamoyltransferase, mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for OTC

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Alternative Name: OTC (OTC Products)

Synonyms: OCTD antibody, 2810428A13Rik antibody, AA589422 antibody, AW457381 antibody, OCT antibody, Plxn2 antibody, mKIAA0463 antibody, F1B16.13 antibody, F1B16_13 antibody, ORNITHINE CARBAMOYLTRANSFERASE antibody, ornithine carbamoyltransferase antibody, BA4351 antibody, PSPTO4164 antibody, PLXN2 antibody, AI265390 antibody, Sf antibody, spf antibody, si:dkey-19h21.3 antibody, ornithine carbamoyltransferase antibody, plexin A2 antibody, ornithine carbamoyltransferase ArgF antibody, ornithine transcarbamylase antibody, OTC antibody, Plxna2 antibody, Otc antibody, argF antibody, argF-2 antibody, atpD-2 antibody, CNC04300 antibody, PLXNA2 antibody, otc antibody

Background: Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

Synonyms: OCTD | Otc | OTCase | P00480

Gene ID: 5009

UniProt: P00480