Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

EGFR antibody (N-Term)

EGFR Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5518909
  • Target See all EGFR Antibodies
    EGFR (Epidermal Growth Factor Receptor (EGFR))
    Binding Specificity
    • 39
    • 38
    • 31
    • 31
    • 30
    • 27
    • 27
    • 26
    • 25
    • 22
    • 19
    • 18
    • 16
    • 16
    • 16
    • 15
    • 15
    • 15
    • 11
    • 11
    • 9
    • 9
    • 9
    • 9
    • 8
    • 8
    • 7
    • 6
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    AA 25-57, N-Term
    Reactivity
    • 750
    • 295
    • 282
    • 25
    • 25
    • 24
    • 19
    • 14
    • 8
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 579
    • 168
    • 14
    • 13
    • 5
    • 4
    • 1
    • 1
    Rabbit
    Clonality
    • 541
    • 239
    • 2
    Polyclonal
    Conjugate
    • 412
    • 58
    • 29
    • 22
    • 19
    • 17
    • 16
    • 16
    • 16
    • 16
    • 16
    • 11
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 8
    • 8
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This EGFR antibody is un-conjugated
    Application
    • 535
    • 252
    • 149
    • 145
    • 127
    • 102
    • 98
    • 93
    • 82
    • 48
    • 37
    • 34
    • 33
    • 18
    • 11
    • 8
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
    Sequence
    LEEKKVCQGT SNKLTQLGTF EDHFLSLQRM FNN
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: epidermal growth factor receptor
    Protein Name: Epidermal growth factor receptor
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human EGFR (25-57aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product EGFR Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Hao, Yang, Ding, Guo, Zhu, Ji, Zhou, Wu: "Paeoniflorin Potentiates the Inhibitory Effects of Erlotinib in Pancreatic Cancer Cell Lines by Reducing ErbB3 Phosphorylation." in: Scientific reports, Vol. 6, pp. 32809, (2018) (PubMed).

    Shangguan, Jiang, Pan, Xiao, Tan, Tie, Qin, Deng, Chen, Wang: "Glucocorticoid mediates prenatal caffeine exposure-induced endochondral ossification retardation and its molecular mechanism in female fetal rats." in: Cell death & disease, Vol. 8, Issue 10, pp. e3157, (2018) (PubMed).

    Cheng, Li, Liu, Cheng, Ma, Qiu: "YC-1 exerts inhibitory effects on MDA-MB-468 breast cancer cells by targeting EGFR in vitro and in vivo under normoxic condition." in: Chinese journal of cancer, Vol. 31, Issue 5, pp. 248-56, (2013) (PubMed).

    Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

  • Target
    EGFR (Epidermal Growth Factor Receptor (EGFR))
    Alternative Name
    EGFR (EGFR Products)
    Background
    The epidermal growth factor receptor (EGFR, ErbB-1, HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). EGFR exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). EGFR and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to EGFR overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of EGFR, called EGFRvIII is often observed.

    Synonyms: Epidermal growth factor receptor, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1, EGFR, ERBB, ERBB1, HER1
    Gene ID
    1956
    UniProt
    P00533
    Pathways
    NF-kappaB Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation, S100 Proteins
You are here:
Support