IL-6 Receptor antibody (C-Term)

Catalog No. ABIN5518926

Product Details anti-IL-6 Receptor Antibody

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Binding Specificity: AA 379-419, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-6 Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.

Sequence: LLCIAIVLRF KKTWKLRALK EGKTSMHPPY SLGQLVPERP R

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Interleukin-6 receptor subunit alpha(IL6R) detection. Tested with WB in Human.
Gene Name: interleukin 6 receptor
Protein Name: Interleukin-6 receptor subunit alpha

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for IL-6 Receptor

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Alternative Name: IL6R (IL6R Products)

Synonyms: IL6R antibody, il-6ra antibody, CD126 antibody, IL-6R-1 antibody, IL-6RA antibody, IL6Q antibody, IL6RA antibody, IL6RQ antibody, gp80 antibody, IL6R1 antibody, Il6ra antibody, IL-6Ralpha antibody, IL-6R antibody, Il6r antibody, interleukin 6 receptor antibody, interleukin 6 receptor, alpha antibody, IL6R antibody, il6r antibody, Il6r antibody, Il6ra antibody

Background: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

Synonyms: Interleukin-6 receptor subunit alpha, IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane glycoprotein 80, gp80, CD126, IL6R

Gene ID: 3570

UniProt: P08887

Pathways: JAK-STAT Signaling, Autophagy, Growth Factor Binding, Cancer Immune Checkpoints