MAK antibody (C-Term)

Catalog No. ABIN5518933

Product Details anti-MAK Antibody

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Binding Specificity: AA 588-623, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAK antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase MAK(MAK) detection. Tested with WB in Human.

Sequence: RTYNPTAKNL NIVNRAQPIP SVHGRTDWVA KYGGHR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase MAK(MAK) detection. Tested with WB in Human.
Gene Name: male germ cell associated kinase
Protein Name: Serine/threonine-protein kinase MAK

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588-623aa RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Alternative Name: MAK (MAK Products)

Synonyms: RP62 antibody, dJ417M14.2 antibody, A930010O05Rik antibody, Ick antibody, fj04c02 antibody, wu:fj04c02 antibody, zgc:56603 antibody, rp62 antibody, xmak antibody, MGC82717 antibody, MGC146434 antibody, male germ cell associated kinase antibody, male germ cell-associated kinase antibody, male germ cell associated kinase L homeolog antibody, MAK antibody, Mak antibody, mak antibody, mak.L antibody

Background: Serine/threonine-protein kinase MAK is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.

Synonyms: Serine/threonine-protein kinase MAK

Gene ID: 4117

UniProt: P20794