Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

AP1S1 antibody (Adaptor Related Protein Complex 1 sigma 1) (AA 1-133) Primary Antibody

AP1S1 Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN560394
$398.67
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    AP1S1
    Binding Specificity
    • 9
    • 8
    • 7
    • 4
    • 2
    • 1
    • 1
    AA 1-133
    Reactivity
    • 26
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 24
    • 2
    Mouse
    Clonality
    • 26
    Polyclonal
    Conjugate
    • 11
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    This AP1S1 antibody is un-conjugated
    Application
    • 21
    • 21
    • 18
    • 15
    • 2
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length recombinant AP1S1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: AP1S1 (AAH03561, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag.

    Immunogen Sequence: MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    AP1S1
    Alternative Name
    AP1S1 (AP1S1 Antibody Abstract)
    Synonyms
    Ube2w, AP1S1, AP19, CLAPS1, MEDNIK, SIGMA1A, WUGSC:H_DJ0747G18.2, zgc:56704, zgc:85689, ap19, ap1s1, claps1, sigma1a, adaptor related protein complex 1 sigma 1 subunit, adaptor-related protein complex 1, sigma 1 subunit, adaptor related protein complex 1 sigma 2 subunit, adaptor protein complex AP-1, sigma 1, adaptor related protein complex 1 sigma 1 subunit L homeolog, AP1S1, Ap1s1, AP1S2, ap1s1, ap1s1.L
    Background
    Full Gene Name: adaptor-related protein complex 1, sigma 1 subunit
    Synonyms: AP19,CLAPS1,FLJ92436,SIGMA1A,WUGSC:H_DJ0747G18.2
    Gene ID
    1174
You are here:
help Support