Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Clusterin antibody (CLU) (AA 402-501) Primary Antibody

CLU Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1A11 unconjugated
Catalog No. ABIN560402
$524.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Clusterin (CLU)
    Binding Specificity
    • 17
    • 12
    • 11
    • 11
    • 10
    • 9
    • 8
    • 8
    • 7
    • 7
    • 7
    • 7
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 402-501
    Reactivity
    • 110
    • 35
    • 34
    • 13
    • 7
    • 7
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 95
    • 41
    • 24
    • 7
    • 2
    • 1
    Mouse
    Clonality
    • 127
    • 42
    Monoclonal
    Conjugate
    • 78
    • 32
    • 24
    • 8
    • 8
    • 7
    • 6
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This Clusterin antibody is un-conjugated
    Application
    • 143
    • 82
    • 71
    • 27
    • 23
    • 21
    • 17
    • 13
    • 11
    • 7
    • 4
    • 4
    • 2
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant CLU.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

    Clone
    1A11
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Clusterin (CLU)
    Alternative Name
    CLU (CLU Antibody Abstract)
    Synonyms
    LOC100136120, clu, MGC53055, zgc:73352, xclu, MGC89163, CLU, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2, DAG, RATTRPM2B, SP40, TRPM2B, Trpm2, Trpmb, AI893575, ApoJ, Cli, D14Ucla3, Sgp-2, Sgp2, Sugp-2, GP80, gpIII, 40, clusterin-1, clusterin L homeolog, clusterin, Clusterin, LOC100136120, clu.L, clu, CLU, clus, Clu, LOC101113728
    Background
    Full Gene Name: clusterin
    Synonyms: AAG4,APOJ,CLI,KUB1,MGC24903,SGP-2,SGP2,SP-40,TRPM-2,TRPM2
    Gene ID
    1191
    NCBI Accession
    NP_001822, NM_001831
    Pathways
    Apoptosis, Negative Regulation of intrinsic apoptotic Signaling
You are here:
help Support