Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CLK3 antibody (CLK3) (AA 36-136) Primary Antibody

CLK3 Reactivity: Human IHC (p), ELISA, WB Host: Mouse Monoclonal 1H2 unconjugated
Catalog No. ABIN560407
$524.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    CLK3
    Binding Specificity
    • 15
    • 9
    • 9
    • 7
    • 3
    • 1
    • 1
    AA 36-136
    Reactivity
    • 41
    • 25
    • 19
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 43
    • 6
    Mouse
    Clonality
    • 45
    • 4
    Monoclonal
    Conjugate
    • 16
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This CLK3 antibody is un-conjugated
    Application
    • 32
    • 25
    • 13
    • 13
    • 5
    • 5
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant CLK3.
    Cross-Reactivity
    Human, Rat (Rattus)
    Immunogen

    immunogen: CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV

    Clone
    1H2
    Isotype
    IgG2b kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CLK3
    Alternative Name
    CLK3 (CLK3 Antibody Abstract)
    Synonyms
    PHCLK3, PHCLK3/152, AI256811, CDC like kinase 3, CDC-like kinase 3, CLK3, Clk3
    Background
    Full Gene Name: CDC-like kinase 3
    Synonyms: FLJ22858,PHCLK3,PHCLK3/152
    Gene ID
    1198
You are here:
help Support