Homeobox A11 (HOXA11) (AA 60-166) antibody

Details for Product No. ABIN561319
Antigen
Epitope
AA 60-166
9
7
7
7
6
4
3
3
2
1
1
1
1
1
Reactivity
Human
70
30
16
7
7
5
4
4
4
2
2
2
2
1
1
Host
Mouse
58
13
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
64
33
11
4
3
2
2
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant HOXA11.
Immunogen

immunogen: HOXA11 (NP_005514, 60 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: VTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAE

Clone 7E12
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name HOXA11 (HOXA11 Antibody Abstract)
Background Full Gene Name: homeobox A11
Synonyms: HOX1,HOX1I
Gene ID 3207
NCBI Accession NP_005514, NM_005523
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Homeobox A11 (HOXA11) (AA 60-166) antibody (ABIN561319) Detection limit for recombinant GST tagged HOXA11 is approximately 0.1ng/ml as a capt...
Image no. 2 for anti-Homeobox A11 (HOXA11) (AA 60-166) antibody (ABIN561319) Western Blot analysis of HOXA11 expression in transfected 293T cell line by HOXA11 mo...