Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ITGA2 antibody (Integrin alpha 2) (AA 30-119) Primary Antibody

ITGA2 Reactivity: Human IF, ELISA, WB Host: Mouse Monoclonal 2B6 unconjugated
Pubmed (1)
Catalog No. ABIN561540
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    ITGA2
    Binding Specificity
    AA 30-119
    • 20
    • 9
    • 9
    • 8
    • 7
    • 7
    • 6
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 149
    • 63
    • 19
    • 14
    • 10
    • 10
    • 9
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Host
    Mouse
    • 89
    • 58
    • 24
    • 5
    • 5
    • 1
    Clonality
    Monoclonal
    Conjugate
    This ITGA2 antibody is un-conjugated
    • 74
    • 26
    • 21
    • 16
    • 10
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunofluorescence (IF), ELISA, Western Blotting (WB)
    • 90
    • 84
    • 54
    • 46
    • 23
    • 14
    • 14
    • 12
    • 11
    • 8
    • 5
    • 3
    • 2
    • 2
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant ITGA2.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL

    Clone
    2B6
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Haglund, Tillgren, Addis, Wenglén, Recklies, Heinegård: "Identification and characterization of the integrin alpha2beta1 binding motif in chondroadherin mediating cell attachment." in: The Journal of biological chemistry, Vol. 286, Issue 5, pp. 3925-34, 2011 (PubMed).

  • Target
    ITGA2
    Alternative Name
    ITGA2 (ITGA2 Antibody Abstract)
    Synonyms
    BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2, DX5, integrin subunit alpha 2, integrin alpha 2, ITGA2, Itga2
    Background
    Full Gene Name: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
    Synonyms: BR,CD49B,GPIa,VLA-2,VLAA2
    Gene ID
    3673
    NCBI Accession
    NP_002194, NM_002203
    Pathways
    CXCR4-mediated Signaling Events, Smooth Muscle Cell Migration, Integrin Complex
You are here:
help Support