DAO antibody (AA 144-180)

Catalog No. ABIN5646959

This anti-DAO antibody is a Rabbit Polyclonal antibody detecting DAO in WB. Suitable for Human and Rat.

Quick Overview for DAO antibody (AA 144-180) (ABIN5646959)

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAO antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DAO Antibody

Binding Specificity: AA 144-180

Purification: Antigen affinity purified

Immunogen: Amino acids 144-180 (STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR) from the human protein were used as the immunogen for the ABP1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ABP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for DAO

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Alternative Name: ABP1 / Amiloride binding protein 1

Background: The AOC1 encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

UniProt: P19801