MPP1 antibody (AA 409-450)

Catalog No. ABIN5646989

Product Details anti-MPP1 Antibody

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Binding Specificity: AA 409-450

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 409-450 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) from the human protein were used as the immunogen for the MPP1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MPP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MPP1

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Alternative Name: MPP1 (MPP1 Products)

Synonyms: AAG12 antibody, DXS552E antibody, EMP55 antibody, MRG1 antibody, PEMP antibody, MGC53500 antibody, MGC89895 antibody, MPP1 antibody, p55 antibody, cb997 antibody, zgc:77039 antibody, wu:fc85f03 antibody, 55kDa antibody, C130070C03Rik antibody, membrane palmitoylated protein 1 antibody, membrane protein, palmitoylated 1 L homeolog antibody, membrane protein, palmitoylated 1 antibody, membrane protein, palmitoylated antibody, MPP1 antibody, mpp1.L antibody, mpp1 antibody, Mpp1 antibody

Background: Membrane Palmitoylated Protein 1, also called '55 kDa erythrocyte membrane protein,' is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q00013