ALDH1B1 antibody (AA 116-156)

Catalog No. ABIN5647015

Product Details anti-ALDH1B1 Antibody

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Binding Specificity: AA 116-156

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ALDH1B1

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Alternative Name: ALDH1B1 (ALDH1B1 Products)

Synonyms: ALDH5 antibody, ALDHX antibody, rf2d antibody, 2700007F14Rik antibody, aldehyde dehydrogenase 1 family member B1 antibody, aldehyde dehydrogenase 5 antibody, aldehyde dehydrogenase 1 family, member B1 antibody, aldehyde dehydrogenase 3B1 antibody, hypothetical protein antibody, ALDH1B1 antibody, aldh5 antibody, Aldh1b1 antibody, MCYG_01035 antibody, MGYG_00956 antibody, PGTG_20239 antibody

Background: Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

UniProt: P30837