ALDH1B1 antibody (AA 116-156)

Catalog No. ABIN5647015

The Rabbit Polyclonal anti-ALDH1B1 antibody is suitable to detect ALDH1B1 in samples from Human, Rat, Mouse and Monkey. It has been validated for WB, IF, FACS and IHC (p).

Quick Overview for ALDH1B1 antibody (AA 116-156) (ABIN5647015)

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Reactivity: Human, Rat, Mouse, Monkey

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH1B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ALDH1B1 Antibody

Binding Specificity: AA 116-156

Purpose: ALDH1B1 Antibody

Purification: Antigen affinity

Immunogen: Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.

Isotype: IgG

Application Details

Application Notes: Differences in protocols and secondary/substrate sensitivity may require the ALDH1B1 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ALDH1B1

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Alternative Name: ALDH1B1

Background: Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

UniProt: P30837