Annexin VIII antibody (AA 20-61)

Catalog No. ABIN5647020

Product Details anti-Annexin VIII Antibody

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Binding Specificity: AA 20-61

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin VIII antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Annexin VIII antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Annexin VIII

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Alternative Name: Annexin VIII (ANXA8 Products)

Synonyms: ANX8 antibody, ANXA8L1 antibody, ANXA8L2 antibody, AI466995 antibody, Anx8 antibody, anx8 antibody, MGC85309 antibody, ANXA8 antibody, annexin A8 antibody, annexin A8 S homeolog antibody, ANXA8 antibody, Anxa8 antibody, anxa8.S antibody, LOC694628 antibody, LOC100052045 antibody

Background: ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

UniProt: P13928