Annexin VIII antibody (AA 20-61)

Catalog No. ABIN5647020

This Rabbit Polyclonal antibody specifically detects Annexin VIII in WB and FACS. It exhibits reactivity toward Human.

Quick Overview for Annexin VIII antibody (AA 20-61) (ABIN5647020)

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin VIII antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Product Details anti-Annexin VIII Antibody

Binding Specificity: AA 20-61

Purpose: Annexin VIII Antibody

Sequence: HFNPDPDAET LYKAMKGIGT NEQAIIDVLT KRSNTQRQQI AK

Purification: Antigen affinity

Immunogen: Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Annexin VIII antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Annexin VIII

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Alternative Name: Annexin VIII

Background: ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

UniProt: P13928