ACTN3 antibody (AA 574-617)

Catalog No. ABIN5647038

This Rabbit Polyclonal antibody specifically detects ACTN3 in WB, IF, IHC (p) and FACS. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ACTN3 antibody (AA 574-617) (ABIN5647038)

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTN3 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Product Details anti-ACTN3 Antibody

Binding Specificity: AA 574-617

Purpose: ACTN3 Antibody

Sequence: EADRERGAIM GIQGEIQKIC QTYGLRPCST NPYITLSPQD INTK

Purification: Antigen affinity

Immunogen: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK) from the human protein were used as the immunogen for the ACTN3 antibody.

Isotype: IgG

Application Details

Application Notes: Differences in protocols and secondary/substrate sensitivity may require the ACTN3 antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Alternative Name: ACTN3

Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

UniProt: Q08043

Pathways: Cell-Cell Junction Organization