IFNGR1 antibody (AA 443-484)

Catalog No. ABIN5647067

The Rabbit Polyclonal anti-IFNGR1 antibody (ABIN5647067) specifically detects IFNGR1 in WB and FACS. The antibody is reactive with Human samples.

Quick Overview for IFNGR1 antibody (AA 443-484) (ABIN5647067)

Target: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFNGR1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS)

Product Details anti-IFNGR1 Antibody

Binding Specificity: AA 443-484

Purpose: IFNGR1 Antibody / CD119

Sequence: QELITVIKAP TSFGYDKPHV LVDLLVDDSG KESLIGYRPT ED

Purification: Antigen affinity

Immunogen: Amino acids 443-484 (QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED) from the human protein were used as the immunogen for the IFNGR1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IFNGR1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the IFNGR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for IFNGR1

Target: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Alternative Name: IFNGR1

Background: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

UniProt: P15260

Pathways: Interferon-gamma Pathway