HOXB1 antibody (AA 176-220)

Catalog No. ABIN5647148

Product Details anti-HOXB1 Antibody

Target: HOXB1 (Homeobox B1 (HOXB1))

Binding Specificity: AA 176-220

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HOXB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HOXB1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HOXB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HOXB1

Target: HOXB1 (Homeobox B1 (HOXB1))

Alternative Name: HOXB1 (HOXB1 Products)

Synonyms: HCFP3 antibody, HOX2 antibody, HOX2I antibody, Hox-2.9 antibody, Z-3 antibody, hoxb1 antibody, id:ibd3532 antibody, Ghox-lab antibody, HOXB-1 antibody, XHox-b1 antibody, hox-2.9 antibody, hoxb-1 antibody, homeobox B1 antibody, homeobox B1a antibody, homeo box B1 antibody, homeobox protein Hox-B1a antibody, homeobox B1 L homeolog antibody, HOXB1 antibody, Hoxb1 antibody, hoxb1a antibody, LOC101062167 antibody, hoxb1.L antibody

Background: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

UniProt: P14653