PPL antibody (AA 1664-1701)

Catalog No. ABIN5647242

This Rabbit Polyclonal antibody specifically detects PPL in WB, IF, IHC (p) and FACS. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PPL antibody (AA 1664-1701) (ABIN5647242)

Target: PPL (Periplakin (PPL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPL antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Product Details anti-PPL Antibody

Binding Specificity: AA 1664-1701

Purpose: Periplakin Antibody

Sequence: DTGRELSPEE AHRAGLIDWN MFVKLRSQEC DWEEISVK

Purification: Antigen affinity

Immunogen: Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Periplakin antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Periplakin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for PPL

Target: PPL (Periplakin (PPL))

Alternative Name: Periplakin

Background: Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

UniProt: O60437