SCTR antibody (AA 398-440)

Catalog No. ABIN5647267

The Rabbit Polyclonal anti-SCTR antibody has been validated for WB. It is suitable to detect SCTR in samples from Human and Rat.

Quick Overview for SCTR antibody (AA 398-440) (ABIN5647267)

Target: SCTR (Secretin Receptor (SCTR))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCTR antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SCTR Antibody

Binding Specificity: AA 398-440

Purification: Antigen affinity purified

Immunogen: Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SCTR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SCTR

Target: SCTR (Secretin Receptor (SCTR))

Alternative Name: SCTR

Background: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.

UniProt: P47872