AKAP2 antibody (AA 813-852)

Catalog No. ABIN5647409

Product Details anti-AKAP2 Antibody

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Binding Specificity: AA 813-852

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the AKAP2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the AKAP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for AKAP2

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Alternative Name: AKAP2 (AKAP2 Products)

Synonyms: AKAP-2 antibody, AKAPKL antibody, PRKA2 antibody, AA959716 antibody, AI649048 antibody, Akap-2 antibody, Akap-kl antibody, B230340M18Rik antibody, Prka2 antibody, akap-kl antibody, AKAP2 antibody, PALM2 antibody, A-kinase anchoring protein 2 antibody, A kinase (PRKA) anchor protein 2 antibody, A-kinase anchoring protein 2 L homeolog antibody, A-kinase anchor protein 2 antibody, AKAP2 antibody, Akap2 antibody, akap2.L antibody, akap2 antibody, LOC101114239 antibody

Background: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9Y2D5