CCDC6 antibody (AA 156-198)

Catalog No. ABIN5647505

Product Details anti-CCDC6 Antibody

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Binding Specificity: AA 156-198

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CCDC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CCDC6

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Alternative Name: CCDC6 (CCDC6 Products)

Synonyms: ccdc6 antibody, fj36e04 antibody, zgc:56563 antibody, zgc:77435 antibody, wu:fj36e04 antibody, MGC53501 antibody, D10S170 antibody, H4 antibody, PTC antibody, TPC antibody, TST1 antibody, 2810012H18Rik antibody, AA536681 antibody, AA960498 antibody, AW061011 antibody, coiled-coil domain containing 6a antibody, coiled-coil domain containing 6 S homeolog antibody, coiled-coil domain containing 6 antibody, ccdc6a antibody, ccdc6.S antibody, CCDC6 antibody, Ccdc6 antibody

Background: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

UniProt: Q16204