CRX antibody (AA 265-299)

Catalog No. ABIN5647525

Product Details anti-CRX Antibody

Target: CRX (Cone-Rod Homeobox (CRX))

Binding Specificity: AA 265-299

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRX antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 265-299 (DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL) from the human protein were used as the immunogen for the CRX antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CRX antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CRX antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CRX

Target: CRX (Cone-Rod Homeobox (CRX))

Alternative Name: CRX (Cone-rod homeobox) (CRX Products)

Synonyms: Xotx5 antibody, Xotx5b antibody, cord2 antibody, crd antibody, otx5 antibody, otx5b antibody, rx antibody, CRX antibody, crx antibody, otx5-b antibody, CORD2 antibody, CRD antibody, LCA7 antibody, OTX3 antibody, Crx1 antibody, otx5-A antibody, cone-rod homeobox antibody, cone-rod homeobox L homeolog antibody, cone-rod homeobox S homeolog antibody, crx antibody, CRX antibody, Crx antibody, crx.L antibody, crx.S antibody

Background: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

UniProt: O43186