ATOH1 antibody (AA 1-30)

Catalog No. ABIN5647595

The Rabbit Polyclonal anti-ATOH1 antibody (ABIN5647595) specifically detects ATOH1 in WB. The antibody is reactive with Human and Rat samples.

Quick Overview for ATOH1 antibody (AA 1-30) (ABIN5647595)

Target: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATOH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATOH1 Antibody

Binding Specificity: AA 1-30

Purpose: ATOH1 Antibody / MATH1 (N-Terminal Region)

Sequence: MSRLLHAEEW AEVKELGDHH RQPQPHHLPQ

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity

Immunogen: Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ) were used as the immunogen for the ATOH1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ATOH1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ATOH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ATOH1

Target: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Alternative Name: ATOH1

Background: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

UniProt: Q92858