TNFAIP6 antibody (AA 46-91)

Catalog No. ABIN5647620

This Rabbit Polyclonal antibody specifically detects TNFAIP6 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for TNFAIP6 antibody (AA 46-91) (ABIN5647620)

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFAIP6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TNFAIP6 Antibody

Binding Specificity: AA 46-91

Purpose: TSG6 Antibody

Sequence: KYKLTYAEAK AVCEFEGGHL ATYKQLEAAR KIGFHVCAAG WMAKGR

Purification: Antigen affinity

Immunogen: Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein were used as the immunogen for the TSG6 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TSG6 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the TSG6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for TNFAIP6

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Alternative Name: TSG6

Background: Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

UniProt: P98066