TMEM107 antibody (AA 22-57)

Catalog No. ABIN5647748

This anti-TMEM107 antibody is a Rabbit Polyclonal antibody detecting TMEM107 in WB and IHC (p). Suitable for Human.

Quick Overview for TMEM107 antibody (AA 22-57) (ABIN5647748)

Target: TMEM107 (Transmembrane Protein 107 (TMEM107))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM107 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-TMEM107 Antibody

Binding Specificity: AA 22-57

Purification: Antigen affinity purified

Immunogen: Amino acids 22-57 (VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) from the human protein were used as the immunogen for the TMEM107 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TMEM107 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the TMEM107 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for TMEM107

Target: TMEM107 (Transmembrane Protein 107 (TMEM107))

Alternative Name: TMEM107

Background: Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of the TMEM107 sequence with the genomic sequence (GRCh38), the gene was mapped to chromosome 17p13.1.

UniProt: Q6UX40