KRIT1 antibody (AA 703-736)

Catalog No. ABIN5647767

Product Details anti-KRIT1 Antibody

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Binding Specificity: AA 703-736

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRIT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the KRIT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KRIT1

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Alternative Name: KRIT1 (KRIT1 Products)

Synonyms: CAM antibody, CCM1 antibody, 2010007K12Rik antibody, A630036P20Rik antibody, AA432855 antibody, AI450393 antibody, AI643869 antibody, BB155247 antibody, BB235701 antibody, Ccm1 antibody, RGD1305929 antibody, krit1 antibody, fb36f07 antibody, san antibody, santa antibody, wu:fb36f07 antibody, zgc:63585 antibody, KRIT1, ankyrin repeat containing antibody, KRIT1 antibody, Krit1 antibody, krit1 antibody

Background: Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O00522

Pathways: Cell RedoxHomeostasis