GTF2A1L antibody (General Transcription Factor IIA, 1-Like) (AA 251-348)

Details for Product anti-GTF2A1L Antibody No. ABIN564784
Antigen
Epitope
AA 251-348
13
10
7
7
4
2
2
2
1
1
1
Reactivity
Human
45
6
5
5
5
4
4
2
1
1
Host
Mouse
34
11
Clonality (Clone)
Monoclonal ()
Conjugate
This GTF2A1L antibody is un-conjugated
2
2
2
2
2
2
Application
Immunofluorescence (IF), ELISA, Western Blotting (WB)
45
23
3
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant ALF.
Immunogen

immunogen: ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQ

Clone 3E4
Isotype IgG2b kappa
Cross-Reactivity Human
Antigen
Alternative Name GTF2A1L (GTF2A1L Antibody Abstract)
Background Full Gene Name: general transcription factor IIA, 1-like
Synonyms: ALF,MGC26254
Gene ID 11036
NCBI Accession NP_006863, NM_006872
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-General Transcription Factor IIA, 1-Like (GTF2A1L) (AA 251-348) antibody (ABIN564784) Western Blot analysis of ALF expression in transfected 293T cell line by ALF monoclon...
Image no. 2 for anti-General Transcription Factor IIA, 1-Like (GTF2A1L) (AA 251-348) antibody (ABIN564784) Immunofluorescence of monoclonal antibody to GTF2A1L on HeLa cell. [antibody concentr...
Image no. 3 for anti-General Transcription Factor IIA, 1-Like (GTF2A1L) (AA 251-348) antibody (ABIN564784) Western Blot detection against Immunogen (36.52 KDa) .
Image no. 4 for anti-General Transcription Factor IIA, 1-Like (GTF2A1L) (AA 251-348) antibody (ABIN564784) Immunofluorescence of monoclonal antibody to GTF2A1L on HeLa cell. (antibody concentr...