ETS1 antibody (AA 67-98)

Catalog No. ABIN5647852

The Rabbit Polyclonal anti-ETS1 antibody is suitable to detect ETS1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for ETS1 antibody (AA 67-98) (ABIN5647852)

Target: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ETS1 Antibody

Binding Specificity: AA 67-98

Purpose: ETS1 Antibody

Sequence: KDPRQWTETH VRDWVMWAVN EFSLKGVDFQ KF

Purification: Antigen affinity

Immunogen: Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ETS1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ETS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ETS1

Target: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Alternative Name: ETS1

Background: Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

UniProt: P14921