MSI1 antibody (AA 21-54)

Catalog No. ABIN5647867

The Rabbit Polyclonal anti-MSI1 antibody is suitable to detect MSI1 in samples from Human, Mouse and Rat. It has been validated for WB, IF and IHC (p).

Quick Overview for MSI1 antibody (AA 21-54) (ABIN5647867)

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI1 antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-MSI1 Antibody

Binding Specificity: AA 21-54

Purpose: Musashi Antibody / MSI1

Sequence: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Purification: Antigen affinity

Immunogen: Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Musashi antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Musashi antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Alternative Name: MSI1 / Musashi 1

Background: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance