NAA15 antibody (AA 244-287)

Catalog No. ABIN5647934

The Rabbit Polyclonal anti-NAA15 antibody (ABIN5647934) specifically detects NAA15 in WB and IHC (p). The antibody is reactive with Human and Mouse samples.

Quick Overview for NAA15 antibody (AA 244-287) (ABIN5647934)

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAA15 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-NAA15 Antibody

Binding Specificity: AA 244-287

Purpose: NARG1 Antibody / NAA15

Sequence: ADVYRGLQER NPENWAYYKG LEKALKPANM LERLKIYEEA WTKY

Purification: Antigen affinity

Immunogen: Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the NARG1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the NARG1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for NAA15

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Alternative Name: NARG1

Background: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.

UniProt: Q9BXJ9