CHRNA5 antibody (AA 44-76)

Catalog No. ABIN5647951

The Rabbit Polyclonal anti-CHRNA5 antibody is suitable to detect CHRNA5 in samples from Human, Mouse and Rat. It has been validated for WB and IHC (p).

Quick Overview for CHRNA5 antibody (AA 44-76) (ABIN5647951)

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CHRNA5 Antibody

Binding Specificity: AA 44-76

Purification: Antigen affinity purified

Immunogen: Amino acids 44-76 (AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF) from the human protein were used as the immunogen for the CHRNA5 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CHRNA5 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CHRNA5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CHRNA5

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Alternative Name: CHRNA5

Background: Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).

UniProt: P30532