Alpha-amylase 1 antibody (AA 20-50)

Catalog No. ABIN5647969

The Rabbit Polyclonal anti-Alpha-amylase 1 antibody is suitable to detect Alpha-amylase 1 in samples from Human, Mouse and Rat. It has been validated for WB and IHC (p).

Quick Overview for Alpha-amylase 1 antibody (AA 20-50) (ABIN5647969)

Target: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Alpha-amylase 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-Alpha-amylase 1 Antibody

Binding Specificity: AA 20-50

Purpose: Alpha Amylase Antibody

Sequence: NTQQGRTSIV HLFEWRWVDI ALECERYLAP K

Purification: Antigen affinity

Immunogen: Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Alpha Amylase antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the Alpha Amylase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for Alpha-amylase 1

Target: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Alternative Name: Alpha Amylase 1

Background: Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.

UniProt: P04745