Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PCDHGA7 antibody (Protocadherin gamma Subfamily A, 7) (AA 347-441) Primary Antibody

PCDHGA7 Reactivity: Human ELISA Host: Mouse Polyclonal unconjugated
Catalog No. ABIN565984
$305.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    PCDHGA7
    Binding Specificity
    AA 347-441
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Polyclonal
    Application
    ELISA
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant PCDHGA7.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: PCDHGA7 (NP_061743, 347 a.a. ~ 441 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: VTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQ

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    PCDHGA7
    Alternative Name
    PCDHGA7 (PCDHGA7 Antibody Abstract)
    Synonyms
    PCDH-GAMMA-A7, PCDHGB4, protocadherin gamma subfamily A, 7, PCDHGA7, Pcdhga7
    Background
    Full Gene Name: protocadherin gamma subfamily A, 7
    Synonyms: PCDH-GAMMA-A7
    Gene ID
    56108
    NCBI Accession
    NP_061743, NM_018920
You are here:
help Support