PCDHGA7 antibody (Protocadherin gamma Subfamily A, 7) (AA 347-441)

Details for Product anti-PCDHGA7 Antibody No. ABIN565984
Antigen
Epitope
AA 347-441
Reactivity
Human
Host
Mouse
Clonality
Polyclonal
Application
ELISA
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant PCDHGA7.
Immunogen

immunogen: PCDHGA7 (NP_061743, 347 a.a. ~ 441 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: VTMTSLSSSIPEDTPLGTVIALFYLQDRDSGKNGEVTCTIPENLPFKLEKSIDNYYRLVTTKNLDRETLSLYNITLKATDGGTPPLSRETHIFMQ

Cross-Reactivity Human
Antigen
Alternative Name PCDHGA7 (PCDHGA7 Antibody Abstract)
Background Full Gene Name: protocadherin gamma subfamily A, 7
Synonyms: PCDH-GAMMA-A7
Gene ID 56108
NCBI Accession NP_061743, NM_018920
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.