Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Protocadherin 19 (PCDH19) (AA 241-340) antibody Primary Antibody

PCDH19 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 2G10 unconjugated
Catalog No. ABIN566131
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Protocadherin 19 (PCDH19)
    Binding Specificity
    • 1
    • 1
    AA 241-340
    Reactivity
    Human
    Host
    • 3
    • 1
    Mouse
    Clonality
    • 3
    • 1
    Monoclonal
    Application
    • 3
    • 2
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant PCDH19.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR

    Clone
    2G10
    Isotype
    IgG2a kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Protocadherin 19 (PCDH19)
    Alternative Name
    PCDH19 (PCDH19 Antibody Abstract)
    Synonyms
    EFMR, EIEE9, B530002L05Rik, Gm717, mKIAA1313, RGD1565392, protocadherin 19, PCDH19, Pcdh19
    Background
    Full Gene Name: protocadherin 19
    Synonyms: DKFZp686P1843,EFMR,KIAA1313
    Gene ID
    57526
    NCBI Accession
    NP_065817, NM_020766
You are here:
help Support