FUT10 antibody (Fucosyltransferase 10 (Alpha (1,3) Fucosyltransferase)) (AA 1-92)

Details for Product anti-FUT10 Antibody No. ABIN566592
Target
Binding Specificity
AA 1-92
15
15
8
2
1
1
Reactivity
Human
45
23
16
Host
Mouse
42
3
Clonality (Clone)
Monoclonal ()
Conjugate
This FUT10 antibody is un-conjugated
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
26
21
12
3
1
Options
Purpose Mouse monoclonal antibody raised against a full length recombinant FUT10.
Immunogen

immunogen: FUT10 (AAH04884, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS

Clone 4H3
Isotype IgG1 kappa
Cross-Reactivity Human
Target
Alternative Name FUT10 (FUT10 Antibody Abstract)
Background Full Gene Name: fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
Synonyms: MGC11141
Gene ID 84750
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Fucosyltransferase 10 (Alpha (1,3) Fucosyltransferase) (FUT10) (AA 1-92) antibody (ABIN566592) Detection limit for recombinant GST tagged FUT10 is approximately 1ng/ml as a capture...
Image no. 2 for anti-Fucosyltransferase 10 (Alpha (1,3) Fucosyltransferase) (FUT10) (AA 1-92) antibody (ABIN566592) FUT10 monoclonal antibody (M04), clone 4H3. Western Blot analysis of FUT10 expression...
Image no. 3 for anti-Fucosyltransferase 10 (Alpha (1,3) Fucosyltransferase) (FUT10) (AA 1-92) antibody (ABIN566592) Western Blot detection against Immunogen (35.86 KDa) .