Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ADHFE1 antibody (Alcohol Dehydrogenase, Iron Containing, 1) (AA 329-418) Primary Antibody

ADHFE1 Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN566821
$465.71
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    ADHFE1
    Binding Specificity
    • 4
    • 2
    • 1
    AA 329-418
    Reactivity
    • 18
    • 14
    • 13
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 16
    • 2
    Mouse
    Clonality
    • 18
    Polyclonal
    Conjugate
    • 11
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This ADHFE1 antibody is un-conjugated
    Application
    • 12
    • 5
    • 4
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant ADHFE1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: ADHFE1 (NP_653251, 329 a.a. ~ 418 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: PERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLAALFEASMKL

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    ADHFE1
    Alternative Name
    ADHFE1 (ADHFE1 Antibody Abstract)
    Synonyms
    adh-8, adh8, zgc:77479, ADHFE1, ADH8, HOT, 6330565B14Rik, AI043035, Adh8, alcohol dehydrogenase, iron containing 1, alcohol dehydrogenase, iron containing, 1, alcohol dehydrogenase, iron containing 1 S homeolog, adhfe1, ADHFE1, adhfe1.S, Adhfe1
    Background
    Full Gene Name: alcohol dehydrogenase, iron containing, 1
    Synonyms: ADH8,FLJ32430,HMFT2263,HOT,MGC48605
    Gene ID
    137872
    NCBI Accession
    NP_653251, NM_144650
You are here:
help Support