FABP5 antibody

Catalog No. ABIN5692847

Product Details anti-FABP5 Antibody

Target: FABP5 (Fatty Acid Binding Protein 5 (Psoriasis-Associated) (FABP5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: KWRLMESHGF EEYMKELGVG LALRKMAAMA KPD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for FABP5 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for FABP5

Target: FABP5 (Fatty Acid Binding Protein 5 (Psoriasis-Associated) (FABP5))

Alternative Name: FABP5 (FABP5 Products)

Synonyms: E-FABP antibody, EFABP antibody, KFABP antibody, PA-FABP antibody, PAFABP antibody, FABP5 antibody, Fabpe antibody, Klbp antibody, mal1 antibody, C-FABP antibody, DA11 antibody, FABP5L1 antibody, fatty acid binding protein 5 antibody, fatty acid binding protein 5, epidermal antibody, fatty acid binding protein 5 (psoriasis-associated) antibody, fatty acid binding protein 5 pseudogene 1 antibody, cationic amino acid transporter 3 pseudogene antibody, FABP5 antibody, Fabp5 antibody, FABP5P1 antibody, LOC609554 antibody

Background:

Synonyms: Fatty acid-binding protein, epidermal, Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP, FABP5

Tissue Specificity: Keratinocytes, highly expressed in psoriatic skin.

Background: FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

UniProt: Q01469